Buy VIP Europe
Buy VIP (Vasoactive Intestinal Peptide) Europe. 28-amino acid neuropeptide for neuroimmune and gastrointestinal research. ≥99% purity. Fast EU delivery.
What is VIP?
VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide belonging to the glucagon/secretin superfamily. Originally isolated from porcine small intestine, VIP is widely distributed in the central and peripheral nervous systems, where it functions as a neurotransmitter, neuromodulator, and potent vasodilator. For published research, see PubMed studies on Vasoactive Intestinal Peptide{:target=“_blank” rel=“noopener”}.
VIP plays critical roles in circadian rhythm synchronisation, gastrointestinal motility, immunomodulation, and neuroprotection, making it one of the most extensively studied neuropeptides in biomedical research.
Best-Peptides supplies research-grade VIP with guaranteed ≥99% purity and full analytical documentation.
How Does VIP Work?
VPAC Receptor Signalling
- VPAC1 activation - High-affinity binding on immune and epithelial cells
- VPAC2 activation - Preferential expression in CNS and smooth muscle
- cAMP production - Gs-coupled adenylyl cyclase stimulation
- PKA/CREB pathway - Downstream transcriptional regulation
Immunomodulatory Effects
- Anti-inflammatory cytokines - IL-10 and TGF-β upregulation
- Pro-inflammatory suppression - TNF-α and IL-6 downregulation
- Treg induction - Regulatory T cell differentiation
- Microglial modulation - Neuroinflammation attenuation
Neuronal and Vascular Actions
- Vasodilation - Potent relaxation of vascular smooth muscle
- Circadian regulation - SCN clock synchronisation
- Neurotransmission - Synaptic modulation in autonomic pathways
Research Applications
Neuroimmunology
- Neuroinflammation - Microglial and astrocyte modulation
- Autoimmune models - T cell differentiation studies
- Cytokine regulation - Anti-inflammatory pathway research
Chronobiology
- Circadian rhythms - Suprachiasmatic nucleus synchronisation
- Clock gene expression - Per/Cry transcription studies
- Sleep-wake regulation - Circadian output pathways
Gastrointestinal Research
- GI motility - Smooth muscle relaxation studies
- Enteric nervous system - Neurotransmitter characterisation
- Mucosal immunity - Gut-associated lymphoid tissue modulation
VIP Specifications
| Specification | Detail |
|---|---|
| CAS Number | 37221-79-7 |
| Molecular Formula | C₁₄₇H₂₃₈N₄₄O₄₃S |
| Molecular Weight | 3326.8 g/mol |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| Purity | ≥99% (HPLC) |
| Appearance | White lyophilised powder |
Reconstitution and Handling
Reconstitution Protocol
- Allow vial to reach room temperature
- Add bacteriostatic water slowly down vial wall
- Gently swirl—do not shake
- Solution should be clear
Storage Recommendations
| Condition | Temperature | Duration |
|---|---|---|
| Lyophilised | -20°C | Up to 24 months |
| Reconstituted | 2-8°C | Up to 4 weeks |
Ordering Information
| Size | Price |
|---|---|
| 10 × 2 mg | €350 |
Minimum order: €200 | 10% discount on orders over €200
Why Choose Best-Peptides for VIP?
- Guaranteed ≥99% purity - HPLC verified
- Full documentation - COA with every order
- EU laboratory tested - Quality assured
- Fast delivery - Express shipping available across Europe
- Research support - Technical assistance
Research Use Statement
For laboratory research only. Not intended for human or veterinary use. Researchers should follow all applicable regulations.
Specifications
| CAS No. | 37221-79-7 |
|---|---|
| Molecular Weight | 3326.8 g/mol |
| Purity | ≥ 99% |
| Storage | -20°C recommended (research-only) |
| Available Sizes | 10 × 2 mg vials |
| Price Range | €350 per pack |
FAQ
VIP is studied for its broad neuromodulatory, immunomodulatory, and vasoactive properties. Research focuses on VPAC1/VPAC2 receptor signalling, circadian rhythm regulation, gastrointestinal motility, and neuroinflammation.
VIP binds to VPAC1 and VPAC2 G-protein coupled receptors, activating adenylyl cyclase and increasing intracellular cAMP. It also has lower affinity for PAC1 receptors, contributing to its broad biological activity profile.
VIP activates VPAC1/VPAC2 receptors coupled to Gs proteins, stimulating cAMP production and PKA activation. This triggers downstream cascades including CREB phosphorylation, ion channel modulation, and anti-inflammatory cytokine release.
Store lyophilised VIP at -20°C for long-term stability. Once reconstituted, keep at 2-8°C and use within 4 weeks. VIP is susceptible to proteolytic degradation—avoid repeated freeze-thaw cycles.
Our VIP is ≥99% pure as verified by HPLC. Each batch includes a Certificate of Analysis with purity data and mass spectrometry identity confirmation.
Yes, VIP is often studied in combination with PACAP, secretin, and other neuropeptides of the same superfamily. Researchers should consider receptor selectivity overlap when designing studies.
Reconstitute in sterile bacteriostatic water or phosphate-buffered saline. Add solvent slowly along the vial wall and gently swirl to dissolve. VIP dissolves readily in aqueous solution.
VIP is available in 2 mg vials, supplied as a pack of 10 × 2 mg for research applications.
Customer Reviews (12)
Based on 12 reviews
Dr. Stefan Richter • 2025-12-05Verified Purchase
VIP consistently shows expected VPAC1/VPAC2 binding profiles in our receptor pharmacology studies. Excellent purity from Best-Peptides.
Leiden Neuroimmunology Lab • 2025-11-18Verified Purchase
Anti-inflammatory activity is clearly demonstrated in our macrophage assays. cAMP response is robust and dose-dependent.
Dr. Camille Lefèvre • 2025-11-01Verified Purchase
Fast delivery to France, superb quality. Our circadian rhythm research is advancing well with this VIP preparation.
Frankfurt Gastroenterology Research • 2025-10-15Verified Purchase
Consistent quality for our GI motility studies. VIP-mediated smooth muscle relaxation is clearly reproducible.
Dr. Lucia Conti • 2025-09-28Verified Purchase
Verified purity exceeds specifications. Critical for our neuroimmune regulation studies in neuronal-glial co-cultures.
Gothenburg Chronobiology Group • 2025-09-11Verified Purchase
VIP is indispensable for our SCN synchronisation studies. Product quality is consistently excellent.
Dr. Piotr Wiśniewski • 2025-08-25Verified Purchase
Arrived within 3 days. Product quality excellent for our enteric nervous system research.
Innsbruck Pharmacology Lab • 2025-08-08Verified Purchase
VIP performs well in our vasodilation studies. cAMP production levels match expected values from literature.
Dr. Willem Bakker • 2025-07-22Verified Purchase
Excellent for VPAC receptor characterisation. Quality documentation is thorough and meets regulatory requirements.
Málaga Neuroscience Institute • 2025-07-05Verified Purchase
Multiple orders, consistently excellent results. Our neuroinflammation research depends on this high-quality VIP.
Dr. Nadia Petrova • 2025-06-18Verified Purchase
Easy ordering, quick delivery to Bulgaria. VIP quality is verified by our independent receptor binding assays.
Bern Peptide Research Centre • 2025-06-01Verified Purchase
High-quality vasoactive intestinal peptide with complete analytical documentation. Highly recommended for peptide researchers.
Related Products
View Complete Catalog
