Buy Sermorelin Europe
Buy Sermorelin Europe. GHRH analogue for growth hormone research. ≥99% purity. Fast EU delivery.
What is Sermorelin?
Sermorelin (GRF 1-29) is a synthetic 29-amino acid peptide corresponding to the first 29 amino acids of human growth hormone releasing hormone (GHRH). It retains the full biological activity of endogenous GHRH(1-44), as the first 29 residues contain the complete receptor-binding domain. For published research, see PubMed studies on Sermorelin{:target=“_blank” rel=“noopener”}.
Sermorelin is one of the most well-characterised GHRH analogues, having been extensively studied since the 1980s. It produces physiological, pulsatile GH release patterns, making it an invaluable tool for studying normal GH axis function.
Best-Peptides supplies research-grade Sermorelin with guaranteed ≥99% purity.
How Does Sermorelin Work?
GHRH Receptor Activation
- GHRH-R binding - High-affinity receptor engagement
- Adenylyl cyclase - cAMP pathway activation
- GH gene transcription - Increased GH synthesis
- Vesicle exocytosis - Stimulated GH release
Physiological GH Release
- Pulsatile secretion - Natural release pattern
- Somatostatin sensitivity - Preserved feedback
- Short half-life - ~10-20 minutes
- Dose-dependent - Predictable responses
Synergy with GHRPs
- GHRP-2 combination - Amplified release
- GHRP-6 combination - Enhanced pulsatility
- Ipamorelin synergy - Selective GH amplification
Research Applications
Pituitary Function
- GHRH receptor studies - Receptor characterisation
- Somatotrope biology - Cell-level GH research
- GH secretion dynamics - Pulsatile release studies
Ageing Research
- Somatopause models - Age-related GH decline
- GH axis restoration - Rejuvenation studies
- Pituitary reserve - Functional assessment
Diagnostic Research
- GH provocation testing - Pituitary function
- GH deficiency models - Diagnostic tools
- Receptor sensitivity - GHRH-R function
Sermorelin Specifications
| Specification | Detail |
|---|---|
| CAS Number | 86168-78-7 |
| Molecular Formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
| Molecular Weight | 3358.9 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ |
| Purity | ≥99% (HPLC) |
| Appearance | White lyophilised powder |
Storage and Handling
| Condition | Temperature | Duration |
|---|---|---|
| Lyophilised | -20°C | Up to 24 months |
| Reconstituted | 2-8°C | Up to 4 weeks |
Ordering Information
| Size | Price |
|---|---|
| 2 mg | From €18 |
| 5 mg | From €35 |
Minimum order: €200 | 10% discount on orders over €200
Research Use Statement
For laboratory research only. Not intended for human or veterinary use. Researchers should follow all applicable regulations.
Specifications
| CAS No. | 86168-78-7 |
|---|---|
| Molecular Weight | 3358.9 g/mol |
| Purity | ≥ 99% |
| Storage | -20°C recommended (research-only) |
| Available Sizes | 10 × 2 mg vials |
| Price Range | €200 per pack |
FAQ
Sermorelin is used to study physiological growth hormone release, GHRH receptor function, pituitary somatotrope activity, and GH axis regulation. It mimics the first 29 amino acids of natural GHRH.
Sermorelin is the natural GHRH(1-29) fragment with a short half-life (~10-20 minutes), producing pulsatile GH release. CJC-1295 has modifications for extended half-life and sustained GH elevation.
Sermorelin binds to GHRH receptors on anterior pituitary somatotropes, activating adenylyl cyclase, raising intracellular cAMP, and stimulating GH gene transcription and release.
Store lyophilised Sermorelin at -20°C. Once reconstituted, keep at 2-8°C and use within 4 weeks.
Our Sermorelin is ≥99% pure as verified by HPLC. Each batch includes a Certificate of Analysis.
Yes, Sermorelin is frequently studied in combination with GHRPs to investigate GHRH-GHRP synergy for amplified GH release.
Reconstitute in sterile bacteriostatic water. Add solvent slowly and gently swirl to dissolve.
Sermorelin is available in 2mg and 5mg vials.
Customer Reviews (12)
Based on 12 reviews
Dr. Klaus Schmidt • 2024-12-11Verified Purchase
Our GHRH receptor studies depend on quality Sermorelin. Best-Peptides delivers consistently. Pulsatile GH release profiles match published data.
Leiden Endocrine Lab • 2024-12-04Verified Purchase
Sermorelin quality is exceptional. Somatotrope activation clearly observable.
Dr. Isabelle Moreau • 2024-11-27Verified Purchase
Fast delivery, excellent quality. GH axis research progressing well.
Hamburg Growth Lab • 2024-11-20Verified Purchase
Consistent quality for our growth hormone secretion research.
Dr. Matteo Colombo • 2024-11-13Verified Purchase
Verified purity exceeds claims. Essential for our GHRH receptor binding studies.
Brussels Hormone Lab • 2024-11-06Verified Purchase
Fast delivery, great quality. GHRH-GHRP synergy studies giving excellent results.
Anna Petersen • 2024-10-30Verified Purchase
Express delivery to Denmark within 2 days. Quality excellent.
Prague Peptide Research • 2024-10-23Verified Purchase
Quality is excellent. GH release kinetics match expected profiles.
Dr. Andreas Keller • 2024-10-16Verified Purchase
Excellent for somatotrope studies. Quality meets our standards.
Lisbon Molecular Lab • 2024-10-09Verified Purchase
Multiple orders, consistently excellent. Our preferred Sermorelin source.
Thomas Berg • 2024-10-02Verified Purchase
Easy ordering, quick delivery. Quality exactly as described.
Warsaw Endocrine Studies • 2024-09-25Verified Purchase
High-quality Sermorelin with proper documentation. Highly recommended.
Related Products
View Complete Catalog
