Buy LL-37 Europe
Buy LL-37 Europe. Human cathelicidin antimicrobial peptide for immune defence research. ≥99% purity. Fast EU delivery.
What is LL-37?
LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino acid α-helical peptide processed from the C-terminal end of the hCAP18 precursor protein. It possesses broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, while simultaneously modulating immune responses. For published research, see PubMed studies on LL-37{:target=“_blank” rel=“noopener”}.
LL-37 bridges innate and adaptive immunity, making it one of the most important research peptides in antimicrobial resistance and host defence research.
Best-Peptides supplies research-grade LL-37 with guaranteed ≥99% purity.
How Does LL-37 Work?
Antimicrobial Mechanisms
- Membrane disruption - Electrostatic interaction
- Pore formation - Bacterial membrane lysis
- Biofilm disruption - Matrix degradation
- Broad-spectrum - Bacteria, fungi, viruses
Immunomodulation
- TLR signalling - Innate immune activation
- Chemotaxis - Immune cell recruitment
- Cytokine modulation - Inflammatory regulation
- Dendritic cell activation - Adaptive immunity bridging
Wound Healing
- Angiogenesis - Blood vessel formation
- Keratinocyte migration - Re-epithelialisation
- Growth factor release - Tissue repair
- Anti-biofilm - Infection prevention
Research Applications
Antimicrobial Resistance
- AMR research - Novel antimicrobial strategies
- Biofilm studies - Prevention and disruption
- Synergy studies - Combination with antibiotics
Immune Defence
- Innate immunity - First-line defence
- Host defence peptides - Cathelicidin biology
- Infection models - In vitro and in vivo
Dermatology Research
- Wound healing - Skin barrier repair
- Rosacea models - LL-37 dysregulation
- Psoriasis - Autoimmune skin disease
LL-37 Specifications
| Specification | Detail |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Weight | 4493.3 g/mol |
| Sequence | [LL-37, 37 aa] |
| Purity | ≥99% (HPLC) |
| Appearance | White lyophilised powder |
Storage and Handling
| Condition | Temperature | Duration |
|---|---|---|
| Lyophilised | -20°C | Up to 24 months |
| Reconstituted | 2-8°C | Up to 2 weeks |
Ordering Information
| Size | Price |
|---|---|
| 5 mg | From €40 |
Minimum order: €200 | 10% discount on orders over €200
Research Use Statement
For laboratory research only. Not intended for human or veterinary use. Researchers should follow all applicable regulations.
Specifications
| CAS No. | 154947-66-7 |
|---|---|
| Molecular Weight | 4493.3 g/mol |
| Purity | ≥ 99% |
| Storage | -20°C recommended (research-only) |
| Available Sizes | 10 × 5 mg vials |
| Price Range | €400 per pack |
FAQ
LL-37 is studied for broad-spectrum antimicrobial activity, immune modulation, wound healing, biofilm disruption, and anti-inflammatory properties. It is the only human cathelicidin.
LL-37 disrupts microbial membranes through electrostatic interaction with negatively charged phospholipids. It also modulates TLR signalling, attracts immune cells, and promotes angiogenesis.
LL-37 is the sole human cathelicidin antimicrobial peptide with both direct antimicrobial activity and immunomodulatory functions, bridging innate and adaptive immunity.
Store lyophilised LL-37 at -20°C. Once reconstituted in sterile water, keep at 2-8°C and use within 2 weeks. Avoid repeated freeze-thaw cycles.
Our LL-37 is ≥99% pure as verified by HPLC. Each batch includes a Certificate of Analysis.
Yes, LL-37 has demonstrated the ability to disrupt established biofilms and prevent biofilm formation, making it valuable for antimicrobial resistance research.
Reconstitute in sterile endotoxin-free water. Add solvent slowly and gently swirl to dissolve.
LL-37 is available in 5mg vials.
Customer Reviews (12)
Based on 12 reviews
Dr. Björn Hagström • 2024-12-09Verified Purchase
Our biofilm disruption studies require quality LL-37. Best-Peptides delivers consistently. Antimicrobial activity confirmed.
Karolinska Infection Lab • 2024-12-02Verified Purchase
LL-37 quality is exceptional. Membrane disruption assays show expected results.
Dr. Mathieu Chapuis • 2024-11-25Verified Purchase
Fast delivery, excellent quality. Antimicrobial resistance research progressing well.
Tübingen Antimicrobial Lab • 2024-11-18Verified Purchase
Consistent quality for our cathelicidin research programme.
Dr. Lucia Greco • 2024-11-11Verified Purchase
Verified purity exceeds claims. Essential for our innate immunity studies.
Copenhagen Infection Lab • 2024-11-04Verified Purchase
Fast delivery, great quality. TLR modulation effects clearly observable.
Jan Eriksen • 2024-10-28Verified Purchase
Express delivery to Norway within 3 days. Quality excellent.
Leiden Antimicrobial Lab • 2024-10-21Verified Purchase
Quality excellent. Biofilm inhibition assays show clear activity.
Dr. Raúl Oliveira • 2024-10-14Verified Purchase
Excellent for host defence peptide studies. Quality meets our requirements.
Dublin Infection Research • 2024-10-07Verified Purchase
Multiple orders, consistently excellent. Essential for our AMR research.
Marta Kowalczyk • 2024-09-30Verified Purchase
Easy ordering, quick delivery. LL-37 quality exactly as described.
Zagreb Microbiology Lab • 2024-09-23Verified Purchase
High-quality LL-37 with proper documentation. Highly recommended.
Related Products
View Complete Catalog
