Buy ACTH 1-39 Europe
Buy ACTH 1-39 (Corticotropin) Europe. Full-length adrenocorticotropic hormone for HPA axis and adrenal research. ≥99% purity. Fast EU delivery.
What is ACTH 1-39?
ACTH 1-39 (Adrenocorticotropic Hormone, Corticotropin) is the full-length 39-amino acid peptide hormone produced by corticotroph cells of the anterior pituitary gland. It is the principal regulator of the hypothalamic-pituitary-adrenal (HPA) axis, acting on melanocortin-2 receptors (MC2R) in the adrenal cortex to stimulate the biosynthesis and release of cortisol and other adrenal steroids. For published research, see PubMed studies on ACTH Corticotropin{:target=“_blank” rel=“noopener”}.
ACTH 1-39 is derived from a larger precursor, proopiomelanocortin (POMC), which also gives rise to α-MSH, β-endorphin, and other bioactive peptides. The first 24 residues are highly conserved and contain the full steroidogenic activity, while the C-terminal region contributes to receptor binding and metabolic stability.
Best-Peptides supplies research-grade ACTH 1-39 with guaranteed ≥99% purity and full analytical documentation.
How Does ACTH 1-39 Work?
MC2R Receptor Activation
- High-affinity MC2R agonism - Primary adrenal receptor target
- MRAP dependency - MC2R requires melanocortin receptor accessory protein for surface expression
- Gs protein coupling - Adenylyl cyclase activation
- cAMP/PKA cascade - Protein kinase A phosphorylation of steroidogenic targets
Steroidogenic Pathway
- StAR protein activation - Cholesterol transport to inner mitochondrial membrane
- CYP11A1 stimulation - Cholesterol side-chain cleavage initiation
- Cortisol biosynthesis - Complete glucocorticoid production cascade
- Aldosterone and DHEA - Secondary steroid output regulation
Melanocortin System Interactions
- MC1R cross-reactivity - Melanogenesis stimulation at high doses
- POMC processing - Precursor-product relationship studies
- α-MSH comparison - Shared N-terminal sequence (1-13)
Research Applications
HPA Axis Research
- Adrenal stimulation tests - Cortisol response characterisation
- Stress biology - HPA axis activation models
- Feedback regulation - Glucocorticoid negative feedback studies
Adrenal Steroidogenesis
- Steroidogenic enzyme induction - CYP11A1, CYP17A1, CYP21A2
- Adrenal cell biology - Zona fasciculata function studies
- StAR protein regulation - Acute steroidogenic response
Melanocortin Receptor Pharmacology
- MC2R characterisation - Receptor binding and signalling
- MRAP interaction - Accessory protein co-expression studies
- Receptor selectivity - MC2R vs other melanocortin receptors
ACTH 1-39 Specifications
| Specification | Detail |
|---|---|
| CAS Number | 9002-60-2 |
| Molecular Formula | C₂₀₇H₃₀₈N₅₆O₅₈S |
| Molecular Weight | 4541.1 g/mol |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Purity | ≥99% (HPLC) |
| Appearance | White lyophilised powder |
Reconstitution and Handling
Reconstitution Protocol
- Allow vial to reach room temperature
- Add bacteriostatic water or 0.1% acetic acid slowly down vial wall
- Gently swirl—do not shake
- Solution should be clear
Storage Recommendations
| Condition | Temperature | Duration |
|---|---|---|
| Lyophilised | -20°C | Up to 24 months |
| Reconstituted | 2-8°C | Up to 4 weeks |
Ordering Information
| Size | Price |
|---|---|
| 10 × 5 mg | €500 |
Minimum order: €200 | 10% discount on orders over €200
Why Choose Best-Peptides for ACTH 1-39?
- Guaranteed ≥99% purity - HPLC verified
- Full documentation - COA with every order
- EU laboratory tested - Quality assured
- Fast delivery - Express shipping available across Europe
- Research support - Technical assistance
Research Use Statement
For laboratory research only. Not intended for human or veterinary use. Researchers should follow all applicable regulations.
Specifications
| CAS No. | 9002-60-2 |
|---|---|
| Molecular Weight | 4541.1 g/mol |
| Purity | ≥ 99% |
| Storage | -20°C recommended (research-only) |
| Available Sizes | 10 × 5 mg vials |
| Price Range | €500 per pack |
FAQ
ACTH 1-39 (Corticotropin) is studied for its central role in the hypothalamic-pituitary-adrenal (HPA) axis. Research focuses on MC2R activation, cortisol biosynthesis, adrenal steroidogenesis, stress response pathways, and melanocortin receptor pharmacology.
ACTH 1-39 is the full-length physiological form of adrenocorticotropic hormone. While ACTH(1-24) retains full steroidogenic activity, the C-terminal region (25-39) contributes to receptor binding kinetics, stability, and immunological properties.
ACTH 1-39 binds with high affinity to MC2R on adrenal cortex cells, activating adenylyl cyclase via Gs proteins. This increases cAMP and activates PKA, which phosphorylates StAR protein and cholesterol side-chain cleavage enzyme to initiate steroidogenesis.
Store lyophilised ACTH 1-39 at -20°C for long-term stability. Once reconstituted, keep at 2-8°C and use within 4 weeks. ACTH is susceptible to oxidation—protect from light and avoid freeze-thaw cycles.
Our ACTH 1-39 is ≥99% pure as verified by HPLC. Each batch includes a Certificate of Analysis with purity data, amino acid analysis, and mass spectrometry identity confirmation.
Yes, ACTH 1-39 is frequently studied in the context of the broader melanocortin system. It is compared with α-MSH, ACTH(1-24), and other MC receptor agonists for receptor selectivity and functional profiling.
Reconstitute in sterile bacteriostatic water or dilute acetic acid (0.1%). Add solvent slowly along the vial wall and gently swirl to dissolve. ACTH 1-39 dissolves readily in acidic aqueous solution.
ACTH 1-39 is available in 5 mg vials, supplied as a pack of 10 × 5 mg for research applications.
Customer Reviews (12)
Based on 12 reviews
Dr. Gerhard Stein • 2025-11-30Verified Purchase
ACTH 1-39 reliably stimulates cortisol production in our adrenal cell cultures. MC2R activation profiles match published literature. Outstanding purity.
Amsterdam Endocrinology Lab • 2025-11-13Verified Purchase
Steroidogenic activity is potent and dose-dependent. StAR protein phosphorylation clearly demonstrated in our Y1 adrenal cell line.
Dr. Margaux Deschamps • 2025-10-27Verified Purchase
Fast delivery to France, exceptional quality. Our HPA axis stress response studies are producing publication-quality data.
Dresden Neuroendocrine Institute • 2025-10-10Verified Purchase
Consistent batch quality for our adrenal steroidogenesis programme. ACTH 1-39 is our primary MC2R agonist reference.
Dr. Paola Santini • 2025-09-23Verified Purchase
Verified full 39-amino acid sequence by mass spectrometry. Biological activity in our adrenocortical cell assays is excellent.
Oslo Stress Research Centre • 2025-09-06Verified Purchase
Full-length ACTH 1-39 is critical for our HPA axis studies. Product quality from Best-Peptides is consistently excellent.
Dr. Lukáš Černý • 2025-08-20Verified Purchase
Received in 4 days. Product quality confirmed by our HPLC and bioassay analysis. Excellent for steroidogenesis studies.
Graz Endocrinology Research • 2025-08-03Verified Purchase
Quality is excellent. Cortisol production time-course data is highly reproducible in our primary adrenal cell cultures.
Dr. Kees Hendriks • 2025-07-17Verified Purchase
Excellent for MC2R pharmacology and adrenal function studies. Documentation meets all our research quality standards.
Bilbao Neuroendocrine Lab • 2025-06-30Verified Purchase
Multiple orders over 12 months, all consistently excellent. Essential for our comparative melanocortin research.
Dr. Sanna Lahtinen • 2025-06-13Verified Purchase
Easy ordering, quick delivery to Finland. ACTH 1-39 quality independently verified by amino acid analysis.
Basel Adrenal Research Lab • 2025-05-27Verified Purchase
High-quality full-length corticotropin with comprehensive documentation. Recommended for endocrinology laboratories across Europe.
Related Products
View Complete Catalog
